PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1044_iso_9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family VOZ
Protein Properties Length: 487aa    MW: 54303.9 Da    PI: 5.6401
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1044_iso_9genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ423.33.8e-1302084271217
                                  VOZ   1 pppsaflgpkcalwdctrpaqgsewl...qdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvq 71 
                                          ppp+aflgpkcalwdc+rpaq  ew+   qdycss+hat+a  eg pg++pvlrp+gi+lkd+llfaalsak+q
  cra_locus_1044_iso_9_len_2142_ver_3 208 PPPAAFLGPKCALWDCPRPAQRLEWCqtsQDYCSSYHATIAPAEGYPGMAPVLRPGGIGLKDNLLFAALSAKAQ 281
                                          89***********************944459******************************************* PP

                                  VOZ  72 gkevgipecegaatakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm 145
                                          g++vgipecegaat+kspwna+elfdl++legetirewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm
  cra_locus_1044_iso_9_len_2142_ver_3 282 GRDVGIPECEGAATTKSPWNAPELFDLAVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVM 355
                                          ************************************************************************** PP

                                  VOZ 146 kefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                                          +efgglkrsyymdpqp++s+ewhlyeyein++d +alyrlelklvd+kks+kgkv++ds++dlqk++ +lta
  cra_locus_1044_iso_9_len_2142_ver_3 356 NEFGGLKRSYYMDPQPMKSYEWHLYEYEINKYDVCALYRLELKLVDGKKSPKGKVANDSVSDLQKQMKKLTA 427
                                          **********************************************************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
XAGGIHKALE EXVMGRVGLW VTIHSKEKEK NRSREESSNS HSFTIVHIYN RTQELLFSLS  60
PNSDQSLFKQ GDNXVESYLN PPPASSLQGG SLGSFSSDIY RLLQLCEEED DATSSLTPPK  120
SEPGIQKVDG GAAFQEEQSF HLLDQCKNTP GANTMGISNM GVAAPLDYHP FDLHQDFEHQ  180
YFTGFEGTGI CGEDALSQIP NFAQNFCPPP AAFLGPKCAL WDCPRPAQRL EWCQTSQDYC  240
SSYHATIAPA EGYPGMAPVL RPGGIGLKDN LLFAALSAKA QGRDVGIPEC EGAATTKSPW  300
NAPELFDLAV LEGETIREWL FFDKPRRAFE SGNRKQRSLP DYNGRGWHES RKQVMNEFGG  360
LKRSYYMDPQ PMKSYEWHLY EYEINKYDVC ALYRLELKLV DGKKSPKGKV ANDSVSDLQK  420
QMKKLTAEFP SDNKRTVKGN SKANTKDVNG SIHSNPNRMP QTNEAFDYGT GAPFEYLVDN  480
LNGYYIT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096373.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A068TU110.0A0A068TU11_COFCA; Uncharacterized protein
STRINGVIT_10s0003g00500.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28182454